PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_70.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 171aa    MW: 19740.9 Da    PI: 6.0114
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_70.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.93e-1556105554
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                                 +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l++ ++
  evm.model.supercontig_70.1  56 RKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLSHVSE 105
                                 689******************************************99877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.4E-1552116IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.34654117IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.34E-1356105No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-1356129No hitNo description
PfamPF001703.6E-1356113IPR004827Basic-leucine zipper domain
CDDcd147028.64E-1757108No hitNo description
PROSITE patternPS0003605974IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MTQNSPAFQL NQFSNPLYSF QIPSHTQDLN TQSSCFSSNS TSDEAEEKQL SLINERKQRR  60
MISNRESARR SRMRKQRHLD ELWSQVVWLR NENHQLIDKL SHVSECHDRV LQENAQLKEE  120
ASELRQMLTD MQLSSPYSTF RDLDDVPCNT AYLKAESSNQ SITGSMDLLG *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16875RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015880480.11e-100PREDICTED: basic leucine zipper 43
SwissprotQ9FMC23e-49BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A067JK132e-89A0A067JK13_JATCU; Uncharacterized protein
STRINGPOPTR_0004s10990.12e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Representative plantOGRP31041129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-53basic leucine-zipper 42